Reference data table
Peptide Amino-Acid Sequence Reference
The amino-acid sequence is a peptide's primary identity descriptor, read from the N-terminus to the C-terminus, and it determines molecular weight, folding, and receptor specificity. This reference lists the full sequence of each peptide in the library; modified residues and terminal groups are shown where present.
Data columnSequence
| Peptide | Sequence |
|---|---|
| AOD-9604 | Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe |
| BPC-157 | Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (one-letter: GEPPPGKPADDAGLV) |
| Bremelanotide | Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH (N-acetyl-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys], lactam-bridged between Asp and Lys side chains) |
| CJC-1295 with DAC | Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (30 residues; backbone = GRF(1-29) with substitutions D-Ala2, Gln8, Ala15, Leu27, plus a C-terminal Lys30 bearing an Nε-maleimidopropionyl DAC linker). One-letter core (substitutions noted): Y-[D-A]-DAIFT-Q-SYRKVL-A-QLSARKLL-QDI-L-SR-K |
| CJC-1295 without DAC | Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (one-letter, C-terminal amide: Y-[D-A]-DAIFTQSYRKVLAQLSARKLLQDILSR-NH2) |
| DSIP | Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu |
| Epitalon | Ala-Glu-Asp-Gly (AEDG) |
| GHK-Cu | Gly-His-Lys (GHK); one-letter GHK, complexed 1:1 with Cu(II) |
| GHRP-2 | D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 (D-Ala-D-beta-(2-naphthyl)-Ala-Ala-Trp-D-Phe-Lys-amide) |
| GHRP-6 | His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 |
| Hexarelin | His-D-2-Methyl-Trp-Ala-Trp-D-Phe-Lys-NH2 |
| Ipamorelin | Aib-His-D-2-Nal-D-Phe-Lys-NH2 |
| KPV | Lys-Pro-Val (KPV) |
| MOTS-c | MRWQEMGYIFYPRKLR (Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg) |
| NAD+ | n/a - dinucleotide coenzyme (adenine + nicotinamide mononucleotides joined by a pyrophosphate bridge) |
| Retatrutide | 39-residue synthetic peptide built on a GIP-based backbone with non-coded residues and C-terminal amidation. Reported representation: Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-(alpha-Me-Leu)-Leu-Asp-Lys-Lys(gamma-Glu-AEEA-AEEA-C20 diacid)-Ala-Gln-Aib-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2. Key modifications: Aib at position 2 and position 20, alpha-methyl-L-leucine at position 13, and fatty-diacid (C20) acylation via a gamma-Glu/AEEA linker on the Lys at position 17. (Position numbering per the cryo-EM structural paper; one-letter backbone approx. YXQGTFTSDYSIXLDKKAQXAFIEYLLEGGPSSGAPPPS-NH2 with X = non-coded residues.) |
| Selank | Thr-Lys-Pro-Arg-Pro-Gly-Pro |
| Semaglutide | H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(modified)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH (31-residue GLP-1(7-37) backbone with Aib8 and Arg34 substitutions; Lys26 acylated with a C18 fatty-diacid via a gamma-Glu/2x-AEEA/OEG linker). One-letter backbone reference (pre-modification): H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Semax | Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP); H-Met-Glu-His-Phe-Pro-Gly-Pro-OH |
| Sermorelin | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2) |
| TB-500 | Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH (Ac-LKKTETQ); corresponds to residues 17-23 of thymosin β-4, containing the conserved LKKTET actin-binding motif |
| Tesamorelin | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL); native human GHRH(1-44) sequence bearing a trans-3-hexenoyl (3-hexenoic acid) group on the alpha-amino group of the N-terminal Tyr1, with C-terminal amidation |
| Thymosin Alpha-1 | Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH |
| Tirzepatide | 39-residue GIP-based backbone with Aib substitutions at positions 2 and 13 and a C20 fatty-diacid moiety (full sequence per Coskun et al. 2018) |
← All reference tablesBrowse peptides →
For in-vitro laboratory research use only. Not for human or animal consumption. Data is provided for research reference and is not medical guidance.
