Sermorelin
Also known as GRF (1-29) · GHRH(1-29)NH2 · GRF 1-29 NH2 · Growth hormone-releasing factor (1-29)
Sermorelin is the N-terminal 1-29 fragment of human GHRH and retains the full intrinsic activity of the parent peptide at the GHRH receptor (GHRHR), a class B G-protein-coupled receptor expressed on anterior-pituitary somatotroph cells.
The overview
What is Sermorelin?
Sermorelin is the N-terminal 1-29 fragment of human GHRH and retains the full intrinsic activity of the parent peptide at the GHRH receptor (GHRHR), a class B G-protein-coupled receptor expressed on anterior-pituitary somatotroph cells. In receptor-signaling terms, agonist binding couples GHRHR to Gs, activating adenylyl cyclase and raising intracellular cAMP, which engages PKA and downstream CREB-mediated transcription. This cascade promotes GH-1 gene transcription and Ca2+-dependent exocytosis of stored growth-hormone secretory granules in cultured somatotrophs. Because signaling occurs through the native receptor, GH output in model systems remains pulsatile and subject to somatostatin (SSTR) counter-regulation and IGF-1 negative feedback, rather than bypassing these control loops. The molecule's short plasma half-life reflects rapid dipeptidyl peptidase-IV cleavage at the Tyr1-Ala2 bond, a determinant studied in stability and analogue-design work. Research framing centers on GHRHR occupancy, cAMP/PKA pathway activation, and comparative somatotroph signaling versus full-length GHRH(1-44) and other secretagogue classes (GHS-R ligands).
In the research
Where Sermorelin shows up
The areas researchers focus on with Sermorelin - and why it has the science community paying attention.
- GHRH receptor (GHRHR) binding and Gs-cAMP-PKA signal transduction in somatotroph models
- In-vitro and ex-vivo pituitary growth-hormone secretory dynamics and pulsatility
- Comparative pharmacology of GHRH analogues vs. GHS-R secretagogues
- Peptide stability / DPP-IV cleavage kinetics and structure-activity relationships
- Use as a provocative agent for probing pituitary GH-secretory reserve in research models
- Neuroendocrine feedback (somatostatin and IGF-1) modulation of the GHRHR axis
By the numbers
The facts that matter
To the molecule
Molecular specifications
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2)Sourced, not claimed
The science behind it
The peer-reviewed studies behind Sermorelin, linked so you can read them yourself.
- Prakash A, Goa KL (1999). Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency BioDrugs.
“Sermorelin is a 29-amino-acid analogue of human growth hormone-releasing hormone (GHRH), and is the shortest synthetic peptide with the full biological activity of GHRH.”
- Walker RF (2006). Sermorelin: a better approach to management of adult-onset growth hormone insufficiency? Clinical Interventions in Aging.
“sermorelin simulates the patients own pituitary gland by binding to specific receptors to increase production and secretion of endogenous hGH.”
- Kirk JM, Trainer PJ, Majrowski WH, Murphy J, Savage MO, Besser GM (1994). Treatment with GHRH(1-29)NH2 in children with idiopathic short stature induces a sustained increase in growth velocity Clinical Endocrinology (Oxford).
“Mean (SD) height velocity (HV) increased from 4.8(0.9)cm/year ... to 7.2(1.6)cm/year [after 12 months of therapy] (P = 0.001).”
- Sigalos JT, Pastuszak AW, Allison A, Ohlander SJ, Herati A, Lindgren MC, Lipshultz LI (2017). Growth Hormone Secretagogue Treatment in Hypogonadal Men Raises Serum Insulin-Like Growth Factor-1 Levels American Journal of Men's Health.
“Mean posttreatment IGF-1 level was 239.0 (54.6) ng/mL (p < .0001).”
Straight answers
Questions, answered
Is Sermorelin approved by the FDA?
No. Sermorelin is not an FDA-approved drug. We supply it as a research-use-only reference compound, identity-verified for purity with a COA on every vial.
What class of compound is Sermorelin?
Sermorelin is classified as: Growth hormone-releasing hormone (GHRH) receptor agonist / growth hormone secretagogue (29-amino-acid GHRH analogue).
What is the molecular weight of Sermorelin?
The molecular weight of Sermorelin is 3357.93 g/mol (average); free base, with a molecular formula of C149H246N44O42S.
What is the CAS number for Sermorelin?
The CAS Registry Number for Sermorelin is 86168-78-7 (free base); 114466-38-5 (acetate salt).
What is the amino acid sequence of Sermorelin?
Sermorelin has the sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2).
Go deeper
More on Sermorelin
Keep exploring
Related peptides
For in-vitro laboratory research use only. Not for human or animal consumption. Bodily introduction into humans or animals is strictly prohibited by law. Sermorelin is not a drug and is not intended to diagnose, treat, cure, or prevent any disease. These statements have not been evaluated by the FDA.