Sermorelin · FAQ

Sermorelin - Frequently Asked Questions

Part of the full Sermorelin guide - a growth hormone-releasing hormone reference compound, identity-verified with a COA on every vial.

Straight answers

Sermorelin, answered

What class of peptide is Sermorelin?

Sermorelin is a growth hormone-releasing hormone (GHRH) receptor agonist and growth hormone secretagogue. Specifically, it is a 29-amino-acid GHRH analogue corresponding to the N-terminal 1-29 fragment of human GHRH, and it retains the full intrinsic activity of the parent peptide at the GHRH receptor.

What is Sermorelin's amino-acid sequence?

The sequence is Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2, or in one-letter code YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. It corresponds to residues 1-29 of endogenous human GHRH and is the shortest fragment retaining full GHRH biological activity.

What is the molecular weight and formula?

The average molecular weight is 3357.93 g/mol as the free base, and the molecular formula is C149H246N44O42S. These values are the basis for molar concentration calculations and mass-spectrometric identity confirmation in laboratory work.

What are the CAS numbers for Sermorelin?

Two CAS Registry Numbers apply: 86168-78-7 for the free base and 114466-38-5 for the acetate salt. The two numbers distinguish the salt forms, which matters for accurate mass accounting since acetate counterions add to the as-supplied weight.

What receptor does Sermorelin target and how does it signal?

It targets the GHRH receptor (GHRHR), a Gs-coupled class B G-protein-coupled receptor on anterior-pituitary somatotrophs. Agonist binding couples the receptor to Gs, activates adenylyl cyclase, raises intracellular cAMP, and engages PKA and CREB-mediated transcription, promoting GH-1 gene transcription and Ca2+-dependent exocytosis of growth-hormone granules.

Why is the C-terminal amidation important?

The carboxy-terminal arginine is amidated (Arg29-NH2), and this amidation is required for receptor potency. It is a structure-function feature, not just notation, so quality checks of a preparation should confirm the amide form, and the 3357.93 g/mol mass corresponds to this amidated species.

Why does Sermorelin have such a short half-life?

It is rapidly cleaved by dipeptidyl peptidase-IV (DPP-IV) at the Tyr1-Ala2 bond, giving a short plasma half-life on the order of minutes. This N-terminal cleavage site is the molecule's principal metabolic vulnerability and is a focal point of stability and analogue-design research.

How is Sermorelin reconstituted for in-vitro research?

For laboratory use, lyophilized peptide is reconstituted in bacteriostatic water, added gently down the vial wall, to form a clear stock. Concentration is calculated from the 3357.93 g/mol weight: 1 mg in 1 mL gives 1 mg/mL, approximately 298 micromolar. This describes laboratory preparation only, not any human dosing protocol.

How should reconstituted material be stored?

Reconstituted stock is handled cold, protected from light and agitation, and split into single-use aliquots to avoid repeated freeze-thaw cycles. Lyophilized, sealed material is the more stable reserve form. Given the peptide's documented DPP-IV lability, minimizing ambient-temperature exposure is prudent. Specific shelf-life figures are not provided in the source data.

What is Sermorelin studied for in research models?

Research areas include GHRHR binding and Gs-cAMP-PKA signal transduction in somatotroph models, in-vitro and ex-vivo pituitary GH secretory dynamics and pulsatility, comparative pharmacology versus GHS-R secretagogues, DPP-IV cleavage kinetics and structure-activity relationships, use as a provocative agent for probing GH-secretory reserve, and somatostatin/IGF-1 feedback modulation of the GHRHR axis.

Does Sermorelin override the body's feedback controls?

No. Because it signals through the native GHRH receptor, GH output in model systems remains pulsatile and subject to somatostatin (SSTR) counter-regulation and IGF-1 negative feedback rather than bypassing these control loops. This is why it is described as a tool for probing intact somatotroph regulation.

Is Sermorelin for human use?

No. In this reference context it is a research-use-only material. All framing here is strictly in-vitro, receptor-signaling, and laboratory-handling oriented; nothing here describes administration, dosing, or any therapeutic, weight-management, or disease-treatment use.

The fine print: products are sold for laboratory research use only and are not for human or animal consumption. Bodily introduction into humans or animals is strictly prohibited by law. Sermorelin is not a drug and is not intended to diagnose, treat, cure, or prevent any disease. These statements have not been evaluated by the FDA.